Vegfa (Mouse) Recombinant Protein
  • Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein

Ref: AB-P4633
Vegfa (Mouse) Recombinant Protein

Información del producto

Mouse Vegfa (120 amino acids) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Vegfa
Gene Alias Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 22339

Enviar uma mensagem


Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein