Ccl5 (Mouse) Recombinant Protein
  • Ccl5 (Mouse) Recombinant Protein

Ccl5 (Mouse) Recombinant Protein

Ref: AB-P4615
Ccl5 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl5 (Q5XZF2) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl5
Gene Alias MuRantes|RANTES|SISd|Scya5|TCP228
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM acetic acid.
Gene ID 20304

Enviar uma mensagem


Ccl5 (Mouse) Recombinant Protein

Ccl5 (Mouse) Recombinant Protein