Fgf9 (Mouse) Recombinant Protein
  • Fgf9 (Mouse) Recombinant Protein

Fgf9 (Mouse) Recombinant Protein

Ref: AB-P4593
Fgf9 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf9 (P54130) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf9
Gene Alias -
Gene Description fibroblast growth factor 9
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM Na2PO4, 75 mM (NH4)2SO4, pH 7.5.
Gene ID 14180

Enviar uma mensagem


Fgf9 (Mouse) Recombinant Protein

Fgf9 (Mouse) Recombinant Protein