Il7 (Mouse) Recombinant Protein
  • Il7 (Mouse) Recombinant Protein

Il7 (Mouse) Recombinant Protein

Ref: AB-P4583
Il7 (Mouse) Recombinant Protein

Información del producto

Mouse Il7 (P10168) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il7
Gene Alias A630026I06Rik|Il-7|MGC129342|hlb368
Gene Description interleukin 7
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 16196

Enviar uma mensagem


Il7 (Mouse) Recombinant Protein

Il7 (Mouse) Recombinant Protein