PDGFB (Human) Recombinant Protein
  • PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein

Ref: AB-P4572
PDGFB (Human) Recombinant Protein

Información del producto

Human PDGFB (P01127) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM acetic acid.
Gene ID 5155

Enviar uma mensagem


PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein