EBI3 (Human) Recombinant Protein
  • EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein

Ref: AB-P4568
EBI3 (Human) Recombinant Protein

Información del producto

Human EBI3 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name EBI3
Gene Alias IL27B
Gene Description Epstein-Barr virus induced 3
Storage Conditions Store at -20C.
Application Key SDS-PAGE
Immunogen Prot. Seq MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution (0.1% Trifluoroacetic Acid (TFA), 0.5% mannitol)
Gene ID 10148

Enviar uma mensagem


EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein