CXCL12 (Beta) (Human) Recombinant Protein
  • CXCL12 (Beta) (Human) Recombinant Protein

CXCL12 (Beta) (Human) Recombinant Protein

Ref: AB-P4566
CXCL12 (Beta) (Human) Recombinant Protein

Información del producto

Human CXCL12 (beta) (P48061-1) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CXCL12
Gene Alias PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1
Gene Description chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 6387

Enviar uma mensagem


CXCL12 (Beta) (Human) Recombinant Protein

CXCL12 (Beta) (Human) Recombinant Protein