IL32 (Human) Recombinant Protein View larger

Human IL32 (AAS80146) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4565

New product

IL32 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name IL32
Gene Alias IL-32alpha|IL-32beta|IL-32delta|IL-32gamma|NK4|TAIF|TAIFa|TAIFb|TAIFc|TAIFd
Gene Description interleukin 32
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 50 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5.
Gene ID 9235

More info

Human IL32 (AAS80146) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IL32 (AAS80146) recombinant protein expressed in <i>Escherichia coli</i>.

Human IL32 (AAS80146) recombinant protein expressed in <i>Escherichia coli</i>.