Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CCL13 (Human) Recombinant Protein
Abnova
CCL13 (Human) Recombinant Protein
Ref: AB-P4425
CCL13 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CCL13 (Q99616) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CCL13
Gene Alias
CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1
Gene Description
chemokine (C-C motif) ligand 13
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Form
Lyophilized
Antigen species Target species
Human
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
No additive
Gene ID
6357
Enviar uma mensagem
CCL13 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*