ADIPOQ (Human) Recombinant Protein
  • ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein

Ref: AB-P4389
ADIPOQ (Human) Recombinant Protein

Información del producto

Human ADIPOQ (Q15848) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized 5 mM Tris and 0.75 mM DTT to pH 8.0, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM Tris, pH 8.0 (0.75 mM DTT)
Gene ID 9370

Enviar uma mensagem


ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein