AB-P4387
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 10 ug |
Gene Name | FLT3LG |
Gene Alias | FL |
Gene Description | fms-related tyrosine kinase 3 ligand |
Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT |
Form | Lyophilized |
Antigen species Target species | Human |
Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Storage Buffer | Lyophilized from 10 mM Na<sub>2</sub>PO<sub>4</sub>, 50 mM NaCl, pH 7.5. |
Gene ID | 2323 |