FGF22 (Human) Recombinant Protein
  • FGF22 (Human) Recombinant Protein

FGF22 (Human) Recombinant Protein

Ref: AB-P4383
FGF22 (Human) Recombinant Protein

Información del producto

Human FGF22 (Q9HCT0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name FGF22
Gene Alias -
Gene Description fibroblast growth factor 22
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 27006

Enviar uma mensagem


FGF22 (Human) Recombinant Protein

FGF22 (Human) Recombinant Protein