View larger
Mouse Tnf (P06804, 80 a.a. - 235 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4370
New product
Tnf (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Tnf |
| Gene Alias | DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a |
| Gene Description | tumor necrosis factor |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS, pH 7.0 |
| Gene ID | 21926 |
More info
Mouse Tnf (P06804, 80 a.a. - 235 a.a.) partial recombinant protein expressed in Escherichia coli.