Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
Tnf (Mouse) Recombinant Protein
Abnova
Tnf (Mouse) Recombinant Protein
Ref: AB-P4370
Tnf (Mouse) Recombinant Protein
Contacte-nos
Información del producto
Mouse Tnf (P06804, 80 a.a. - 235 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
Tnf
Gene Alias
DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a
Gene Description
tumor necrosis factor
Storage Conditions
Store at -20C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Form
Lyophilized
Antigen species Target species
Mouse
Storage Buffer
Lyophilized from PBS, pH 7.0
Gene ID
21926
Enviar uma mensagem
Tnf (Mouse) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*