Vegfa (Mouse) Recombinant Protein
  • Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein

Ref: AB-P4367
Vegfa (Mouse) Recombinant Protein

Información del producto

Mouse Vegfa (Q00731, 27 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Vegfa
Gene Alias Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at -20C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 22339

Enviar uma mensagem


Vegfa (Mouse) Recombinant Protein

Vegfa (Mouse) Recombinant Protein