View larger
Mouse S100a1 (NP_035439, 1 a.a. - 94 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P4346
New product
S100a1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | S100a1 |
| Gene Alias | AI266795|S100|S100a |
| Gene Description | S100 calcium binding protein A1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol). |
| Gene ID | 20193 |
More info
Mouse S100a1 (NP_035439, 1 a.a. - 94 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.