S100a1 (Mouse) Recombinant Protein
  • S100a1 (Mouse) Recombinant Protein

S100a1 (Mouse) Recombinant Protein

Ref: AB-P4346
S100a1 (Mouse) Recombinant Protein

Información del producto

Mouse S100a1 (NP_035439, 1 a.a. - 94 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name S100a1
Gene Alias AI266795|S100|S100a
Gene Description S100 calcium binding protein A1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol).
Gene ID 20193

Enviar uma mensagem


S100a1 (Mouse) Recombinant Protein

S100a1 (Mouse) Recombinant Protein