Shh (Mouse) Recombinant Protein
  • Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein

Ref: AB-P4339
Shh (Mouse) Recombinant Protein

Información del producto

Mouse Shh (NP_033196, 25 a.a. - 198 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Shh
Gene Alias 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081
Gene Description sonic hedgehog
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 20423

Enviar uma mensagem


Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein