View larger
Mouse Ifnb1 (NP_034640, 22 a.a. - 182 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P4337
New product
Ifnb1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Ifnb1 |
| Gene Alias | IFN-beta|IFNB|Ifb |
| Gene Description | interferon beta 1, fibroblast |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM HEPES, 0.5 M NaCl, pH 6.0 (10% glycerol). |
| Gene ID | 15977 |
More info
Mouse Ifnb1 (NP_034640, 22 a.a. - 182 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.