PSMG4 (Human) Recombinant Protein View larger

Human PSMG4 (NP_001122063, 1 a.a. - 123 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P4325

New product

PSMG4 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PSMG4
Gene Alias C6orf86|PAC4|bA506K6.2
Gene Description proteasome (prosome, macropain) assembly chaperone 4
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 389362

More info

Human PSMG4 (NP_001122063, 1 a.a. - 123 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human PSMG4 (NP_001122063, 1 a.a. - 123 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human PSMG4 (NP_001122063, 1 a.a. - 123 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.