UPK3A (Human) Recombinant Protein View larger

Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P4324

New product

UPK3A (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name UPK3A
Gene Alias MGC119178|UPIII|UPIIIA|UPK3
Gene Description uroplakin 3A
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.25 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
Form Liquid
Antigen species Target species Human
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, 150 mM NaCl, pH 8.0 (20% glycerol, 2 mM DTT).
Gene ID 7380

More info

Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.