Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
SIT1 (Human) Recombinant Protein
Abnova
SIT1 (Human) Recombinant Protein
Ref: AB-P4317
SIT1 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human SIT1 (NP_055265, 1 a.a. -196 a.a. ) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
SIT1
Gene Alias
MGC125908|MGC125909|MGC125910|RP11-331F9.5|SIT
Gene Description
signaling threshold regulating transmembrane adaptor 1
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
0.25 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS
Form
Liquid
Antigen species Target species
Human
Quality control testing
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol).
Gene ID
27240
Enviar uma mensagem
SIT1 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*