View larger
Human KAT2A (NP_066564, 411 a.a. - 837 a.a. ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3938
New product
KAT2A (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | KAT2A |
| Gene Alias | GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5 |
| Gene Description | K(lysine) acetyltransferase 2A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDY |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS PAGE. |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, 1 mM EDTA, pH 8.0 (5 mM DTT, 40% glycerol). |
| Gene ID | 2648 |
More info
Human KAT2A (NP_066564, 411 a.a. - 837 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.