RGS21 (Human) Recombinant Protein
  • RGS21 (Human) Recombinant Protein

RGS21 (Human) Recombinant Protein

Ref: AB-P3930
RGS21 (Human) Recombinant Protein

Información del producto

Human RGS21 (NP_001034241, 1 a.a. - 152 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name RGS21
Gene Alias -
Gene Description regulator of G-protein signaling 21
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMPVKCCFYRSPTAETMTWSENMDTLLANQAGLDAFRIFLKSEFSEENVEFWLACEDFKKTKNADKIASKAKMIYSEFIEADAPKEINIDFGTRDLISKNIAEPTLKCFDEAQKLIYCLMAKDSFPRFLKSEIYKKLVNSQQVPNHKKWLPFL
Form Liquid
Antigen species Target species Human
Storage Buffer In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 30% glycerol).
Gene ID 431704

Enviar uma mensagem


RGS21 (Human) Recombinant Protein

RGS21 (Human) Recombinant Protein