View larger
Human FABP2 (NP_000125.1, 1 a.a. - 132 a.a.) full-length recombinant protein with His tag at N-terminal expressed in <i>Escheric
AB-P3801
New product
FABP2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | FABP2 |
| Gene Alias | FABPI|I-FABP|MGC133132 |
| Gene Description | fatty acid binding protein 2, intestinal |
| Storage Conditions | Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 10% SDS-PAGE Result |
| Storage Buffer | In PBS (50% glycerol). |
| Gene ID | 2169 |
More info
Human FABP2 (NP_000125.1, 1 a.a. - 132 a.a.) full-length recombinant protein with His tag at N-terminal expressed in Escherichia coli.