C14orf166 (Human) Recombinant Protein View larger

Human C14orf166 (NM_016039) full-length recombinant protein expressed in yeast.

AB-P3734

New product

C14orf166 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name C14orf166
Gene Alias CGI-99|CGI99|CLE|CLE7|LCRP369|RLLM1
Gene Description chromosome 14 open reading frame 166
Storage Conditions Store at -20ºC. <br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene ID 51637

More info

Human C14orf166 (NM_016039) full-length recombinant protein expressed in yeast.

Enviar uma mensagem

Human C14orf166 (NM_016039) full-length recombinant protein expressed in yeast.

Human C14orf166 (NM_016039) full-length recombinant protein expressed in yeast.