Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
DIABLO (Human) Recombinant Protein
Abnova
DIABLO (Human) Recombinant Protein
Ref: AB-P3733
DIABLO (Human) Recombinant Protein
Contacte-nos
Información del producto
Human DIABLO (NP_063940.1) full-length recombinant protein expressed in yeast.
Información adicional
Size
100 ug
Gene Name
DIABLO
Gene Alias
DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene Description
diablo homolog (Drosophila)
Storage Conditions
Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Form
Liquid
Antigen species Target species
Human
Storage Buffer
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene ID
56616
Enviar uma mensagem
DIABLO (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*