AIP (Human) Recombinant Protein
  • AIP (Human) Recombinant Protein

AIP (Human) Recombinant Protein

Ref: AB-P3724
AIP (Human) Recombinant Protein

Información del producto

Human AIP (AAI04828, 1 a.a. - 330 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name AIP
Gene Alias ARA9|FKBP16|FKBP37|SMTPHN|XAP2
Gene Description aryl hydrocarbon receptor interacting protein
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLL
Form Liquid
Antigen species Target species Human
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 9049

Enviar uma mensagem


AIP (Human) Recombinant Protein

AIP (Human) Recombinant Protein