THPO (Human) Recombinant Protein
  • THPO (Human) Recombinant Protein

THPO (Human) Recombinant Protein

Ref: AB-P3680
THPO (Human) Recombinant Protein

Información del producto

Human THPO (P40225, 1 a.a. - 353 a.a.) full-length recombinant protein. expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name THPO
Gene Alias MGC163194|MGDF|MKCSF|ML|MPLLG|TPO
Gene Description thrombopoietin
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7
Gene ID 7066

Enviar uma mensagem


THPO (Human) Recombinant Protein

THPO (Human) Recombinant Protein