View larger
Human PTH (P01270, 32 a.a. - 115 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3663
New product
PTH (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PTH |
| Gene Alias | PTH1 |
| Gene Description | parathyroid hormone |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PB |
| Gene ID | 5741 |
More info
Human PTH (P01270, 32 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.