NRG1 (Human) Recombinant Protein View larger

Human NRG1 (Q02297, 177 a.a. - 237 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P3658

New product

NRG1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name NRG1
Gene Alias ARIA|GGF|GGF2|HGL|HRG|HRG1|HRGA|NDF|SMDF
Gene Description neuregulin 1
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10 mM PB, pH 7.0 (2% mannitol, 0.5% HAS)
Gene ID 3084

More info

Human NRG1 (Q02297, 177 a.a. - 237 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human NRG1 (Q02297, 177 a.a. - 237 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human NRG1 (Q02297, 177 a.a. - 237 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.