View larger
Human CCL18 (P55774, 21 a.a. - 89 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3655
New product
CCL18 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | CCL18 |
| Gene Alias | AMAC-1|AMAC1|CKb7|DC-CK1|DCCK1|MIP-4|PARC|SCYA18 |
| Gene Description | chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5 |
| Gene ID | 6362 |
More info
Human CCL18 (P55774, 21 a.a. - 89 a.a.) partial recombinant protein expressed in Escherichia coli.