View larger
Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3651
New product
CCL3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCL3 |
| Gene Alias | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene Description | chemokine (C-C motif) ligand 3 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.5 |
| Gene ID | 6348 |
More info
Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.