CCL13 (Human) Recombinant Protein View larger

Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.

AB-P3648

New product

CCL13 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25 ug
Gene Name CCL13
Gene Alias CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1
Gene Description chemokine (C-C motif) ligand 13
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM PB, 100mM NaCl, pH 7.5
Gene ID 6357

More info

Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in Escherichia coli.

Enviar uma mensagem

Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.

Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.