IL33 (Human) Recombinant Protein
  • IL33 (Human) Recombinant Protein

IL33 (Human) Recombinant Protein

Ref: AB-P3638
IL33 (Human) Recombinant Protein

Información del producto

Human IL33 (O95760, 112 a.a. - 270 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL33
Gene Alias C9orf26|DKFZp586H0523|DVS27|NF-HEV|NFEHEV|RP11-575C20.2
Gene Description interleukin 33
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS
Gene ID 90865

Enviar uma mensagem


IL33 (Human) Recombinant Protein

IL33 (Human) Recombinant Protein