IFNA2 (Human) Recombinant Protein
  • IFNA2 (Human) Recombinant Protein

IFNA2 (Human) Recombinant Protein

Ref: AB-P3622
IFNA2 (Human) Recombinant Protein

Información del producto

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 3440

Enviar uma mensagem


IFNA2 (Human) Recombinant Protein

IFNA2 (Human) Recombinant Protein