IFNA2 (Human) Recombinant Protein View larger

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P3621

New product

IFNA2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 3440

More info

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.