View larger
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3616
New product
CXCL2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | CXCL2 |
| Gene Alias | CINC-2a|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2 |
| Gene Description | chemokine (C-X-C motif) ligand 2 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | RAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM Tris, pH 8.0 |
| Gene ID | 2920 |
More info
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.