AB-P3615
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 25 ug |
Gene Name | CXCL1 |
Gene Alias | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
Gene Description | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | Lyophilized from 40 mM NaCl, 10 mM PB, pH 7.0 |
Gene ID | 2919 |