CXCL1 (Human) Recombinant Protein
  • CXCL1 (Human) Recombinant Protein

CXCL1 (Human) Recombinant Protein

Ref: AB-P3615
CXCL1 (Human) Recombinant Protein

Información del producto

Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name CXCL1
Gene Alias FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1
Gene Description chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 40 mM NaCl, 10 mM PB, pH 7.0
Gene ID 2919

Enviar uma mensagem


CXCL1 (Human) Recombinant Protein

CXCL1 (Human) Recombinant Protein