CSF2 (Human) Recombinant Protein
  • CSF2 (Human) Recombinant Protein

CSF2 (Human) Recombinant Protein

Ref: AB-P3614
CSF2 (Human) Recombinant Protein

Información del producto

Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CSF2
Gene Alias GMCSF|MGC131935|MGC138897
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 1437

Enviar uma mensagem


CSF2 (Human) Recombinant Protein

CSF2 (Human) Recombinant Protein