View larger
Human FGF10 (O15520, 1 a.a. - 208 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.
AB-P3607
New product
FGF10 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | FGF10 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 10 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.0 |
| Gene ID | 2255 |
More info
Human FGF10 (O15520, 1 a.a. - 208 a.a.) full-length recombinant protein. expressed in Escherichia coli.