View larger
Human CCL21 (O00585, 1 a.a. - 134 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.
AB-P3606
New product
CCL21 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCL21 |
| Gene Alias | 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4 |
| Gene Description | chemokine (C-C motif) ligand 21 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5 |
| Gene ID | 6366 |
More info
Human CCL21 (O00585, 1 a.a. - 134 a.a.) full-length recombinant protein. expressed in Escherichia coli.