View larger
Human BMP4 (P12644, 292 a.a. - 408 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3598
New product
BMP4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | BMP4 |
| Gene Alias | BMP2B|BMP2B1|MCOPS6|ZYME |
| Gene Description | bone morphogenetic protein 4 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM Na<sub>2</sub>CO<sub>3</sub>, pH 9 |
| Gene ID | 652 |
More info
Human BMP4 (P12644, 292 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.