BDNF (Human) Recombinant Protein
  • BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein

Ref: AB-P3595
BDNF (Human) Recombinant Protein

Información del producto

Human BDNF (P23560, 129 a.a. - 247 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from citric acid, pH 5.7
Gene ID 627

Enviar uma mensagem


BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein