View larger
Human DEFB103A (P81534, 21 a.a. - 67 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3593
New product
DEFB103A (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | DEFB103A |
| Gene Alias | BD-3 |
| Gene Description | defensin, beta 103A |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | HGGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized 100 mM NaCl, 20mM PB, pH 7.4 |
| Gene ID | 414325 |
More info
Human DEFB103A (P81534, 21 a.a. - 67 a.a.) partial recombinant protein expressed in Escherichia coli.