TNFRSF17 (Human) Recombinant Protein
  • TNFRSF17 (Human) Recombinant Protein

TNFRSF17 (Human) Recombinant Protein

Ref: AB-P3590
TNFRSF17 (Human) Recombinant Protein

Información del producto

Human TNFRSF17 (Q02223, 1 a.a. - 54 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TNFRSF17
Gene Alias BCM|BCMA|CD269
Gene Description tumor necrosis factor receptor superfamily, member 17
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 30% acetonitrile, 0.1% TFA, pH 7.5
Gene ID 608

Enviar uma mensagem


TNFRSF17 (Human) Recombinant Protein

TNFRSF17 (Human) Recombinant Protein