CLC (Human) Recombinant Protein
  • CLC (Human) Recombinant Protein

CLC (Human) Recombinant Protein

Ref: AB-P3578
CLC (Human) Recombinant Protein

Información del producto

Human CLC (NP_001819, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name CLC
Gene Alias LGALS10|LPPL_HUMAN|MGC149659
Gene Description Charcot-Leyden crystal protein
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 1178

Enviar uma mensagem


CLC (Human) Recombinant Protein

CLC (Human) Recombinant Protein