DECR1 (Human) Recombinant Protein View larger

Human DECR1 (NP_001350, 35 a.a. - 335 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3575

New product

DECR1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name DECR1
Gene Alias DECR|NADPH|SDR18C1
Gene Description 2,4-dienoyl CoA reductase 1, mitochondrial
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPC
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 1666

More info

Human DECR1 (NP_001350, 35 a.a. - 335 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human DECR1 (NP_001350, 35 a.a. - 335 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human DECR1 (NP_001350, 35 a.a. - 335 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.