DNAJC19 (Human) Recombinant Protein
  • DNAJC19 (Human) Recombinant Protein

DNAJC19 (Human) Recombinant Protein

Ref: AB-P3569
DNAJC19 (Human) Recombinant Protein

Información del producto

Human DNAJC19 (NP_660304, 19 a.a. - 116 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name DNAJC19
Gene Alias TIM14|TIMM14
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 19
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (2 mM DTT, 10% glycerol).
Gene ID 131118

Enviar uma mensagem


DNAJC19 (Human) Recombinant Protein

DNAJC19 (Human) Recombinant Protein