View larger
Human GABARAPL2 (NP_009216, 1 a.a. - 117 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>
AB-P3565
New product
GABARAPL2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | GABARAPL2 |
| Gene Alias | ATG8|GATE-16|GATE16|GEF-2|GEF2 |
| Gene Description | GABA(A) receptor-associated protein-like 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (5 mM DTT, 20% glycerol). |
| Gene ID | 11345 |
More info
Human GABARAPL2 (NP_009216, 1 a.a. - 117 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.