RUNX3 (Human) Recombinant Protein
  • RUNX3 (Human) Recombinant Protein

RUNX3 (Human) Recombinant Protein

Ref: AB-P3554
RUNX3 (Human) Recombinant Protein

Información del producto

Human RUNX3 (NP_004341, 53 a.a. - 186 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name RUNX3
Gene Alias AML2|CBFA3|FLJ34510|MGC16070|PEBP2aC
Gene Description runt-related transcription factor 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQK
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID 864

Enviar uma mensagem


RUNX3 (Human) Recombinant Protein

RUNX3 (Human) Recombinant Protein