View larger
Human FDX1 (NP_004100, 61 a.a. - 184 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3539
New product
FDX1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FDX1 |
| Gene Alias | ADX|FDX|LOH11CR1D |
| Gene Description | ferredoxin 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH8.0 (10% glycerol). |
| Gene ID | 2230 |
More info
Human FDX1 (NP_004100, 61 a.a. - 184 a.a.) partial recombinant protein expressed in Escherichia coli.